University of Nebraska–Lincoln

Sequence Searches

Please enter one or more search protein sequence below in FASTA format.

A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column.

For an explanation of the FASTA search algorithm please see the Support page.

Example:

>gi|15485500|emb|CAC67520.1| ribulose 1,5-bisphosphate carboxylase/oxygenase
DYNVKDTDILALFRITPQPGVDPVEAAAAVAGESSTATWTVVWTDLLTAC DIYRAKAYRVDPVPGTSDQFFAYVAYECDLFEEGSLANLTASIIGNVFGF KAVKALRLEDMRIPFAYLKTFQGPATGLIVERERLDKFGR

Simple Fasta Search

 

 

Show Histogram :

    

Expectation Value Limit (High):

  

Expectation Value Limit (Low):

  

Max. Number of Alignments:

  

Show Z-Score instead of Bit Score :

  
  • Note: Sliding 80mer Searches Prior to Septermber 12, 2007 may have identified matches of exactly 35% identity. However to be consistant with Codex 2005 the calculation of the cutoff value for a match has been changed to Greater than 35%.
  • Note 2: The sequences in the FASTA searchable database might vary from the sequences described in the public literature, as this database is not updated on a daily basis.
  • Note 3: We do not observe or log any protein sequences submitted through this website.